Please fill out the following fields. Orders will be processed on an availability basis.

Reagents	hWT
Last Name
First Name
Title
Organization
Address 1
Address 2
City
State/Province
Country
Postal Code
FedEx Account Number
Phone Number
Email
Briefly describe the amount needed and justify the usage of that amount.

View Reagents List

hWT - Human NBD1 Wild Type

Human NBD1 Expression and Purification Protocol

Refolding Kinetics Protocol

Misfolding Kinetics Protocol

Thermodynamic Stability Protocol

ATP Filter Binding Protocol

 

 

Data for Human - 12 files, 1515 KB total.

• hNBD1-WT-011408.pdf - 112298 bytes, last modified on 7/1/2009 11:58:32 AM.
• hNBD1-WT-021208.pdf - 776769 bytes, last modified on 7/1/2009 11:58:22 AM.
• hNBD1-WT-022208.pdf - 98361 bytes, last modified on 7/1/2009 11:58:22 AM.
• hNBD1-WT-040706..pdf - 17087 bytes, last modified on 7/1/2009 11:58:22 AM.
• hNBD1-WT-060507.pdf - 21565 bytes, last modified on 7/1/2009 11:58:22 AM.
• hNBD1-WT-062907.pdf - 104202 bytes, last modified on 7/1/2009 11:58:22 AM.
• hNBD1-WT-071108.pdf - 206620 bytes, last modified on 7/1/2009 11:58:22 AM.
• hNBD1-WT-071206.pdf - 17504 bytes, last modified on 7/1/2009 11:58:22 AM.
• hNBD1-WT-072606.pdf - 17427 bytes, last modified on 7/1/2009 11:58:24 AM.
• hNBD1-WT-110806.pdf - 12055 bytes, last modified on 7/1/2009 11:58:24 AM.
• hNBD1-WT-110807.pdf - 83173 bytes, last modified on 7/1/2009 11:58:24 AM.
• hNBD1-WT-120806.pdf - 84527 bytes, last modified on 7/1/2009 11:58:24 AM.

Protein Expression

04-07-06 hWT NBD1 Prep (Word Document)

06-02-06 hWT NBD1 Prep (Word Document)

06-29-07 hWT NBD1 Prep (Word Document)

 

NBD Sequence for hWT-NBD1 (389-673)

(S)TTEVVMENVTAFWEEGFGELFEKAKQNNNNRKTSNGDDSLFFSNFSLLGTPVLKDINFKIER

GQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQFSWIMPGTIKENIIFGVSYDEY

RYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDV

LTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILNEGSSYFYGTFSELQNLQPDFSSKL

MGCDSFDQFSAERRNSILTETLHRFSLEG

Please fill out the form below to leave feedback on reagents used.

Select the reagent used

hWT

Please list all relevant feedback concerning this reagent, or if you used multiple reagents list them as well and provide feedback on them.

Please provide your name and information relevant to reaching you.