Please fill out the following fields. Orders will be processed on an availability basis.

Reagents	mWT
Last Name
First Name
Title
Organization
Address 1
Address 2
City
State/Province
Country
Postal Code
FedEx Account Number
Phone Number
Email
Briefly describe the amount needed and justify the usage of that amount.

View Reagents List

mWT - Murine NBD1 Wild Type

Murine NBD₁ Expression and Purification Protocol 

Refolding Kinetics Protocol

Misfolding Kinetics Protocol

Thermodynamic Stability Protocol

ATP Filter Binding Protocol

 

 

Data for Human - 8 files, 1361 KB total.

• mNBD1-WT-032008.pdf - 752200 bytes, last modified on 7/1/2009 11:58:26 AM.
• mNBD1-WT-032706.pdf - 27895 bytes, last modified on 7/1/2009 11:58:26 AM.
• mNBD1-WT-032907.pdf - 78859 bytes, last modified on 7/1/2009 11:58:26 AM.
• mNBD1-WT-060307.pdf - 203876 bytes, last modified on 7/1/2009 11:58:26 AM.
• mNBD1-WT-090507.pdf - 265465 bytes, last modified on 7/1/2009 11:58:26 AM.
• mNBD1-WT-090706.pdf - 12210 bytes, last modified on 7/1/2009 11:58:28 AM.
• mNBD1-WT-111606.pdf - 12144 bytes, last modified on 7/1/2009 11:58:28 AM.
• mNBD1-WT-112008.pdf - 40649 bytes, last modified on 7/1/2009 11:58:28 AM.

Protein Expression

03-27-06 mWT NBD1 Prep (Word Document)

03-29-07 mWT NBD1 Prep (Word Document)

NBD Sequence for mWT-NBD1 (389-673)

(S)TTGIIMENVTAFWEEGFGELLEKVQQSNGDRKHSSDENNVSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSL
LMLILGELEASEGIIKHSGRVSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVT
LSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFY
GTFSELQSLRPDFSSKLMGYDTFDQFTEERRSSILTETLRRFSVDD

Please fill out the form below to leave feedback on reagents used.

Select the reagent used

mWT

Please list all relevant feedback concerning this reagent, or if you used multiple reagents list them as well and provide feedback on them.

Please provide your name and information relevant to reaching you.